Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD2 (CD2 molecule) Expressed in HEK293 for Antibody Discovery, Partial (25-209aa) (CAT#: MPX0532K)

This product is a 48 kDa Human CD2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD2
  • Protein Length
  • Partial (25-209aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 48 kDa
  • TMD
  • 1
  • Sequence
  • KEITNALETWGALGQDINLDIPSFQM
    SDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTD
    DQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTTLTCEVMN
    GTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEP
    VSCPEKGLD

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • CD2
  • Full Name
  • CD2 molecule
  • Introduction
  • The protein encoded by this gene is a surface antigen found on all peripheral blood T-cells. The encoded protein interacts with LFA3 (CD58) on antigen presenting cells to optimize immune recognition. A locus control region (LCR) has been found in the 3' flanking sequence of this gene.
  • Alternative Names
  • CD2; T11; SRBC; LFA-2; T-cell surface antigen CD2; CD2 antigen (p50), sheep red blood cell receptor; LFA-3 receptor; T-cell surface antigen T11/Leu-5; erythrocyte receptor; lymphocyte-function antigen-2; rosette receptor; CD2 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us