Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD200R1 (CD200 receptor 1) Expressed in NS0 for Antibody Discovery, Partial (27-266aa) (CAT#: MPX0588K)

This product is a 53.4 kDa Human CD200R1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD200R1
  • Protein Length
  • Partial (27-266aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 53.4 kDa
  • TMD
  • 1
  • Sequence
  • LCMDEKQITQNYSKVLAEVNTSWP
    VKMATNAVLCCPPIALRNLIIITWEIILRGQPSCTKAYRKETNETKETNC
    TDERITWVSRPDQNSDLQIRPVAITHDGYYRCIMVTPDGNFHRGYHLQVL
    VTPEVTLFQNRNRTAVCKAVAGKPAAQISWIPEGDCATKQEYWSNGTVTV
    KSTCHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIIL
    TIIILTIVGFIWLLKV

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD200R1
  • Full Name
  • CD200 receptor 1
  • Introduction
  • This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants.
  • Alternative Names
  • CD200R1; OX2R; MOX2R; CD200R; HCRTR2; cell surface glycoprotein CD200 receptor 1; CD200 cell surface glycoprotein receptor; MOX2 receptor; cell surface glycoprotein OX2 receptor 1; cell surface glycoprotein receptor CD200; CD200 receptor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us