Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD24 (CD24 molecule) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (27-80aa) (CAT#: MPX4225K)

This product is a 32.3kDa Human CD24 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD24
  • Protein Length
  • Partial (27-80aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 32.3kDa
  • Sequence
  • SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CD24
  • Full Name
  • CD24 molecule
  • Introduction
  • This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. This gene was missing from previous genome assemblies, but is properly located on chromosome 6. Non-transcribed pseudogenes have been designated on chromosomes 1, 15, 20, and Y. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • CD24A; signal transducer CD24; CD24 antigen (small cell lung carcinoma cluster 4 antigen)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us