Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD300A (CD300a molecule) Expressed in NS0 for Antibody Discovery, Partial (18-178aa) (CAT#: MPX0768K)

This product is a 44.0 kDa Human CD300A membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD300A
  • Protein Length
  • Partial (18-178aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 44.0 kDa
  • TMD
  • 1
  • Sequence
  • LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWC
    RPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGT
    YWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPP
    VSSTTLFAVGATHSASIQEETEEVVNSQ

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD300A
  • Full Name
  • CD300a molecule
  • Introduction
  • This gene encodes a member of the CD300 glycoprotein family of cell surface proteins found on leukocytes involved in immune response signaling pathways. This gene is located on chromosome 17 in a cluster with all but one of the other family members. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • CD300A; IRC1; IRC2; CLM-8; IRp60; IGSF12; CMRF35H; CMRF-35H; CMRF35-H; CMRF35H9; CMRF35-H9; IRC1/IRC2; CMRF-35-H9; CMRF35-like molecule 8; CD300 antigen-like family member A; CD300a antigen; CMRF35H leukocyte immunoglobulin-like receptor; NK inhibitory receptor; immunoglobulin superfamily member 12; inhibitory receptor protein 60; leukocyte membrane antigen; CD300a molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us