Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD300C (CD300c molecule) Expressed in NS0 for Antibody Discovery, Partial (29-183aa) (CAT#: MPX0428K)

This product is a 43.5 kDa Human CD300C membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD300C
  • Protein Length
  • Partial (29-183aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 43.5 kDa
  • TMD
  • 1
  • Sequence
  • MTVAGPVGGSLSVQCRYEKEHR
    TLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENL
    TEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSG
    PPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD300C
  • Full Name
  • CD300c molecule
  • Introduction
  • The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes.
  • Alternative Names
  • CD300C; LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1; CMRF35-like molecule 6; CD300 antigen-like family member C; CD300c antigen; CMRF35 antigen; CMRF35 leukocyte immunoglobulin-like receptor; CMRF35A leukocyte immunoglobulin-like receptor; immunoglobulin superfamily member 16; CD300c molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us