Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD300LF (CD300 molecule like family member f) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (20-156aa) (CAT#: MPX4417K)

This product is a 17.5kDa Human CD300LF membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD300LF
  • Protein Length
  • Partial (20-156aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 17.5kDa
  • TMD
  • 1
  • Sequence
  • TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CD300LF
  • Full Name
  • CD300 molecule like family member f
  • Introduction
  • This gene encodes a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. The encoded protein is an inhibitory receptor. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • CD300LF; CLM1; NKIR; CLM-1; IREM1; LMIR3; CD300f; IREM-1; IgSF13; CMRF35-like molecule 1; CD300 antigen-like family member F; NK inhibitory receptor; immune receptor expressed on myeloid cells 1; immunoglobin superfamily member 13; immunoglobulin superfamily member 13; inhibitory receptor IREM1; CD300 molecule like family member f

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us