Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD320 (CD320 molecule) Expressed in NS0 for Antibody Discovery, Partial (31-231aa) (CAT#: MPX0641K)

This product is a 47.2 kDa Human CD320 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD320
  • Protein Length
  • Partial (31-231aa)
  • Protein Class
  • Growth factor
  • Molecular Weight
  • 47.2 kDa
  • TMD
  • 1
  • Sequence
  • LEAAASPLSTPTSAQAAGPS
    SGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQC
    PPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTW
    RCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMG
    PPVTLESVPSVGNATSSSAGDQSGSPTAYGV

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in Tris-Citrate and NaCl.

Target

  • Target Protein
  • CD320
  • Full Name
  • CD320 molecule
  • Introduction
  • This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • CD320; 8D6; 8D6A; TCBLR; TCN2R; CD320 antigen; 8D6 antigen; FDC-SM-8D6; FDC-signaling molecule 8D6; transcobalamin 2 receptor; transcobalamin receptor; CD320 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us