Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD33 (CD33 molecule) Expressed in E.coli with 10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (18-259aa) (CAT#: MPX4667K)

This product is a 46.7 kDa Human CD33 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD33
  • Protein Length
  • Partial (18-259aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 46.7 kDa
  • TMD
  • 1
  • Sequence
  • DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CD33
  • Full Name
  • CD33 molecule
  • Alternative Names
  • CD33; p67; SIGLEC3; SIGLEC-3; myeloid cell surface antigen CD33; CD33 antigen (gp67); CD33 molecule transcript; gp67; sialic acid-binding Ig-like lectin 3; CD33 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us