Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD52 (CD52 molecule) Full Length (CAT#: MPC4344K) Made to Order

This product is a made-to-order Human CD52 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD52
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Sequence
  • MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFV
    ANAIIHLFCFS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • CD52
  • Full Name
  • CD52 molecule
  • Alternative Names
  • CD52; HE5; CDW52; EDDM5; CAMPATH-1 antigen; CD52 antigen (CAMPATH-1 antigen); CDW52 antigen (CAMPATH-1 antigen); HEL-S-171mP; cambridge pathology 1 antigen; epididymal secretory protein E5; epididymis secretory sperm binding protein Li 171mP; human epididymis-specific protein 5; CD52 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us