Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD69 (CD69 molecule) Expressed in NS0 for Antibody Discovery, Partial (64-199aa) (CAT#: MPX0166K)

This product is a 17 kDa Human CD69 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD69
  • Protein Length
  • Partial (64-199aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 17 kDa
  • TMD
  • 1
  • Sequence
  • GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFIS
    TVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPG
    HPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Product Description

  • Expression Systems
  • NS0
  • Tag
  • 9xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 250 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE with silver staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD69
  • Full Name
  • CD69 molecule
  • Introduction
  • This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
  • Alternative Names
  • CD69; AIM; EA1; MLR-3; CLEC2C; GP32/28; BL-AC/P26; early activation antigen CD69; C-type lectin domain family 2, member C; CD69 antigen (p60, early T-cell activation antigen); activation inducer molecule (AIM/CD69); early T-cell activation antigen p60; early lymphocyte activation antigen; leukocyte surface antigen Leu-23; CD69 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us