Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD79B (CD79b molecule) Expressed in CHO for Antibody Discovery, Partial (29-159aa) (CAT#: MPX0278K)

This product is a 16 kDa Human CD79B membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD79B
  • Protein Length
  • Partial (29-159aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 16 kDa
  • TMD
  • 1
  • Sequence
  • ARSEDRYRNPKGSACSRIWQSP
    RFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQ
    NESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQ
    LKQRNTLKD

Product Description

  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 250 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD79B
  • Full Name
  • CD79b molecule
  • Introduction
  • The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
  • Alternative Names
  • CD79B; B29; IGB; AGM6; B-cell antigen receptor complex-associated protein beta chain; B-cell-specific glycoprotein B29; CD79b antigen (immunoglobulin-associated beta); CD79b molecule, immunoglobulin-associated beta; Ig-beta; immunoglobulin-associated B29 protein; CD79b molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us