Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IFITM1 (Interferon induced transmembrane protein 1) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1108K)

This product is a Human IFITM1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IFITM1
  • Protein Length
  • Full Length
  • Protein Class
  • Immunity
  • TMD
  • 2
  • Sequence
  • MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • IFITM1
  • Full Name
  • Interferon induced transmembrane protein 1
  • Alternative Names
  • IFITM1; 9-27; CD225; IFI17; LEU13; DSPA2a; dispanin subfamily A member 2a; interferon-induced protein 17; interferon-inducible protein 9-27; leu-13 antigen; Interferon induced transmembrane protein 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us