Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD84 (CD84 molecule) Expressed in NS0 for Antibody Discovery, Partial (22-220aa) (CAT#: MPX0603K)

This product is a 23.6 kDa Human CD84 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD84
  • Protein Length
  • Partial (22-220aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 23.6 kDa
  • TMD
  • 1
  • Sequence
  • KDSEIFTVNGILGESVTFPVNIQEPRQVK
    IIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLR
    MEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCN
    VTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVS
    NNSDSISARQLCADIAMGFR

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD84
  • Full Name
  • CD84 molecule
  • Introduction
  • This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • CD84; LY9B; hCD84; mCD84; SLAMF5; SLAM family member 5; CD84 antigen (leukocyte antigen); cell surface antigen MAX.3; hly9-beta; leucocyte differentiation antigen CD84; leukocyte antigen CD84; leukocyte differentiation antigen CD84; signaling lymphocytic activation molecule 5; CD84 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us