Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD86 (CD86 molecule) expressed in CHO for Antibody Discovery (CAT#: MP0058Q)

This product is a 51.2 kDa Human CD86 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD86
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Transcription Factors, Transmembrane
  • Molecular Weight
  • 51.2 kDa
  • TMD
  • 1
  • Sequence
  • LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHGGPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK

Product Description

  • Expression Systems
  • CHO
  • Endotoxin
  • < 1 EU/µg
  • Purity
  • >95% pure by SDS-PAGE and HPLC analyses
  • Buffer
  • Lyophilized purified protein

Target

  • Target Protein
  • CD86
  • Full Name
  • CD86 molecule
  • Introduction
  • This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.
  • Alternative Names
  • B7-2; B7.2; B70; CD28LG2; LAB72;T-lymphocyte activation antigen CD86; B lymphocyte activation antigen B7-2; BU63; CD86 antigen (CD28 antigen ligand 2, B7-2 antigen); CTLA-4 counter-receptor B7.2; FUN-1; Activation B7-2 antigen; CD86

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us