Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD99L2 (CD99 molecule like 2) Expressed in CHO for Antibody Discovery, Partial (20-188aa) (CAT#: MPX0684K)

This product is a 44.5 kDa Human CD99L2 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD99L2
  • Protein Length
  • Partial (20-188aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 44.5 kDa
  • TMD
  • 1
  • Sequence
  • VQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTT
    RAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFD
    LADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGM
    VAEPGTIA

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD99L2
  • Full Name
  • CD99 molecule like 2
  • Introduction
  • This gene encodes a cell-surface protein that is similar to CD99. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • CD99L2; CD99B; MIC2L1; CD99 antigen-like protein 2; MIC2 like 1; MIC2-like protein 1; CD99 molecule like 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us