Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CDIP1 (Cell death inducing p53 target 1) for Antibody Discovery (CAT#: MP0131X)

This product is a 48.51 kDa Human CDIP1 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CDIP1
  • Protein Length
  • Full-length
  • Molecular Weight
  • 48.51 kDa
  • Sequence
  • MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHPMPQPGFIPPHMSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • CDIP1
  • Full Name
  • Cell death inducing p53 target 1
  • Introduction
  • CDIP1 (Cell Death Inducing P53 Target 1) is a Protein Coding gene. Diseases associated with CDIP1 include Cervical Dystonia and Cranio-Facial Dystonia. Among its related pathways are Apoptosis and Autophagy and NF-kappaB Signaling. An important paralog of this gene is LITAF
  • Alternative Names
  • CDIP,I1; cell death inducing protein,transmembrane protein I1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us