Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SRD5A2 (Steroid 5 alpha-reductase 2) for Antibody Discovery (CAT#: MP1293X)

This product is a 28 kDa Human SRD5A2 membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SRD5A2
  • Protein Length
  • Full-length
  • Molecular Weight
  • 28 kDa
  • TMD
  • 4
  • Sequence
  • MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF

Product Description

  • Application
  • Antibody Production
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • NO
  • Protein Format
  • Liposome
  • Purification
  • None
  • Buffer
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol

Target

  • Target Protein
  • SRD5A2
  • Full Name
  • Steroid 5 alpha-reductase 2
  • Introduction
  • This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).
  • Alternative Names
  • 3-oxo-5-alpha-steroid 4-dehydrogenase 2; 5 alpha-SR2; S5AR 2; SR type 2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); type II 5-alpha reductase

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us