Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CEACAM19 (CEA cell adhesion molecule 19) Expressed in HEK293 for Antibody Discovery, Partial (33-157aa) (CAT#: MPX0678K)

This product is a 40 kDa Human CEACAM19 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CEACAM19
  • Protein Length
  • Partial (33-157aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 40 kDa
  • TMD
  • 1
  • Sequence
  • ALYIQKIPEQPQKNQDLL
    LSVQGVPDTFQDFNWYLGEETYGGTRLFTYIPGIQRPQRDGSAMGQRDIV
    GFPNGSMLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPST
    HLPTNAG

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CEACAM19
  • Full Name
  • CEA cell adhesion molecule 19
  • Alternative Names
  • CEACAM19; CEAL1; CEACM19; carcinoembryonic antigen-related cell adhesion molecule 19; carcinoembryonic antigen related cell adhesion molecule 19; carcinoembryonic antigen-like 1; CEA cell adhesion molecule 19

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us