Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CEACAM3 (CEA cell adhesion molecule 3) Expressed in NS0 for Antibody Discovery, Partial (35-155aa) (CAT#: MPX0407K)

This product is a 14 kDa Human CEACAM3 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CEACAM3
  • Protein Length
  • Partial (35-155aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 14 kDa
  • TMD
  • 1
  • Sequence
  • KLTIESMPLSVAEGKE
    VLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRET
    IYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPV
    GAVAG

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • CEACAM3
  • Full Name
  • CEA cell adhesion molecule 3
  • Introduction
  • This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described.
  • Alternative Names
  • CEACAM3; CEA; CGM1; W264; W282; CD66D; carcinoembryonic antigen-related cell adhesion molecule 3; CD66d antigen; carcinoembryonic antigen CGM1; carcinoembryonic antigen gene family member 1; carcinoembryonic antigen related cell adhesion molecule 3; nonspecific cross-reacting antigen; CEA cell adhesion molecule 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us