Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CHST4 (Carbohydrate sulfotransferase 4) Expressed in CHO for Antibody Discovery, Partial (29-386aa) (CAT#: MPX0786K)

This product is a 43 kDa Human CHST4 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CHST4
  • Protein Length
  • Partial (29-386aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 43 kDa
  • TMD
  • 1
  • Sequence
  • HNISSLSMKAQPERMHVLVLSSWRSGSSFVGQ
    LFGQHPDVFYLMEPAWHVWMTFKQSTAWMLHMAVRDLIRAVFLCDMSVFDAYMEPGPRRQ
    SSLFQWENSRALCSAPACDIIPQDEIIPRAHCRLLCSQQPFEVVEKACRSYSHVVLKEVR
    FFNLQSLYPLLKDPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKED
    QPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLP
    HLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYR
    HVRSEQEQRNLLLDLLSTWTVPEQIH

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >85%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Supplied as a 0.2 μm filtered solution in Tris, NaCl and Glycerol.

Target

  • Target Protein
  • CHST4
  • Full Name
  • Carbohydrate sulfotransferase 4
  • Introduction
  • This gene encodes an N-acetylglucosamine 6-O sulfotransferase. The encoded enzyme transfers sulfate from 3'phosphoadenosine 5'phospho-sulfate to the 6-hydroxyl group of N-acetylglucosamine on glycoproteins. This protein is localized to the Golgi and is involved in the modification of glycan structures on ligands of the lymphocyte homing receptor L-selectin. Alternate splicing in the 5' UTR results in multiple transcript variants that encode the same protein.
  • Alternative Names
  • CHST4; GST3; LSST; GlcNAc6ST2; HECGLCNAC6ST; GST-3; HEC-GlcNAc6ST; L-selectin ligand sulfotransferase; N-acetylglucosamine 6-O-sulfotransferase 2; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4; galactose/N-acetylglucosamine/N-acetylgalactosamine 6-O-sulfotransferase 3; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3; glcNAc6ST-2; gn6st-2; high endothelial cells N-acetylglucosamine 6-O-sulfotransferase; Carbohydrate sulfotransferase 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us