Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PIANP (PILR alpha associated neural protein) Expressed in HEK293 for Antibody Discovery, Partial (76-178aa) (CAT#: MPX0649K)

This product is a 37 kDa Human PIANP membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PIANP
  • Protein Length
  • Partial (76-178aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 37 kDa
  • TMD
  • 1
  • Sequence
  • SRRQVLPGTAPPATPSGFEEGPPSS
    QYPWAIVWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRG
    DGDGLILGEAPATLRPFLFGGRGEGVDP

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • PIANP
  • Full Name
  • PILR alpha associated neural protein
  • Introduction
  • This gene encodes a ligand for the paired immunoglobin-like type 2 receptor alpha, and so may be involved in immune regulation. Alternate splicing results in multiple transcript variants encoding different proteins.
  • Alternative Names
  • PIANP; PANP; LEDA1; leda-1; C12orf53; PILR-associating neural protein; liver endothelial differentiation-associated protein-1; paired immunoglobin-like type 2 receptor-associating neural protein; PILR alpha associated neural protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us