Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLDN10 (Claudin 10) Full Length (CAT#: MPC0489K) Made to Order

This product is a 24.4 kDa Human CLDN10 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLDN10
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 24.4 kDa
  • TMD
  • 4
  • Sequence
  • MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW
    KACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFG
    MKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPL
    FVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSV
    MSSRTKYHGGEDFKTTNPSKQFDKNAYV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CLDN10
  • Full Name
  • Claudin 10
  • Introduction
  • This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The expression level of this gene is associated with recurrence of primary hepatocellular carcinoma. Six alternatively spliced transcript variants encoding different isoforms have been reported, but the transcript sequences of some variants are not determined.
  • Alternative Names
  • OSPL; HELIX; OSP-L; CPETRL3; claudin-10; OSP-like protein; oligodendrocyte-specific protein-like; CLDN10; Claudin 10

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us