Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLDN19 (Claudin 19) Full Length (CAT#: MPC4097K) Made to Order

This product is a made-to-order Human CLDN19 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLDN19
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 4
  • Sequence
  • MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGL
    WMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVV
    GMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWYATLVTQEFFN
    PSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYR
    PGPSAAAREPVVKLPASAKGPLGV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • CLDN19
  • Full Name
  • Claudin 19
  • Introduction
  • The product of this gene belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO). HOMGO is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocular abnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
  • Alternative Names
  • CLDN19; HOMG5; claudin-19; Claudin 19

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us