Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLDN4 (Claudin 4) Expressed in E.coli for Antibody Discovery, Partial (29-160aa) (CAT#: MPX0057K)

This product is a 11 kDa Human CLDN4 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLDN4
  • Protein Length
  • Partial (29-160aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 11 kDa
  • TMD
  • 4
  • Sequence
  • MKHHHHHHASMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARLEVLFQGPTAHNIIQDFYNPLVASGQKREM

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • His tag at N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • > 90% SDS-PAGE
  • Buffer
  • pH: 8.00, Constituents: 0.3% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • CLDN4
  • Full Name
  • Claudin 4
  • Introduction
  • The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems.
  • Alternative Names
  • CPER; CPE-R; CPETR; CPETR1; WBSCR8; hCPE-R; claudin-4; CPE-receptor; Clostridium perfringens enterotoxin receptor 1; Williams-Beuren syndrome chromosomal region 8 protein; CLDN4; Claudin 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us