Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLDN5 (Claudin 5) Full Length (CAT#: MPC1709K) Made to Order

This product is a 23.1 kDa Human CLDN5 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLDN5
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 23.1 kDa
  • TMD
  • 4
  • Sequence
  • MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGL
    WMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLA
    GAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDP
    SVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKY
    SAPRRPTATGDYDKKNYV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CLDN5
  • Full Name
  • Claudin 5
  • Introduction
  • This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
  • Alternative Names
  • CLDN5; AWAL; BEC1; TMVCF; TMDVCF; CPETRL1; claudin-5; transmembrane protein deleted in VCFS; transmembrane protein deleted in velocardiofacial syndrome; Claudin 5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us