Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLEC14A (C-type lectin domain containing 14A) Expressed in HEK293 for Antibody Discovery, Partial (22-397aa) (CAT#: MPX0692K)

This product is a 66 kDa Human CLEC14A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC14A
  • Protein Length
  • Partial (22-397aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 66 kDa
  • TMD
  • 1
  • Sequence
  • EHPTADRAGCSASGACYSLHHATMKRQAA
    EEACILRGGALSTVRAGAELRAVLALLRAGPGPGGGSKDLLFWVALERRR
    SHCTLENEPLRGFSWLSSDPGGLESDTLQWVEEPQRSCTARRCAVLQATG
    GVEPAGWKEMRCHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHS
    AALDFSPPGTEVSALCRGQLPISVTCIADEIGARWDKLSGDVLCPCPGRY
    LRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSGEGQPTLGGTG
    VPTRRPPATATSPVPQRTWPIRVDEKLGETPLVPEQDNSVTSIPEIPRWG
    SQSTMSTLQMSLQAESKATITPSGSVISKFNSTTSSATPQAFDSSSA

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CLEC14A
  • Full Name
  • C-type lectin domain containing 14A
  • Introduction
  • This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This family member plays a role in cell-cell adhesion and angiogenesis. It functions in filopodia formation, cell migration and tube formation. Due to its presence at higher levels in tumor endothelium than in normal tissue endothelium, it is considered to be a candidate for tumor vascular targeting.
  • Alternative Names
  • CLEC14A; CEG1; EGFR-5; C14orf27; C-type lectin domain family 14 member A; ClECT and EGF-like domain containing protein; epidermal growth factor receptor 5; C-type lectin domain containing 14A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us