Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLEC2D (C-type lectin domain family 2 member D) Full Length (CAT#: MPC2281K) Made to Order

This product is a 21.8 kDa Human CLEC2D membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC2D
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 21.8 kDa
  • TMD
  • 1
  • Sequence
  • MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVC
    GMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQ
    RFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTE
    WTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CLEC2D
  • Full Name
  • C-type lectin domain family 2 member D
  • Introduction
  • This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene.
  • Alternative Names
  • CLEC2D; CLAX; LLT1; OCIL; C-type lectin related f; C-type lectin superfamily 2, member D; LLT-1; lectin-like NK cell receptor; lectin-like transcript 1; osteoclast inhibitory lectin; C-type lectin domain family 2 member D

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us