Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MARCH2 (Membrane associated ring-CH-type finger 2) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0934K)

This product is a Human MARCH2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MARCH2
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • Molecular Weight
  • 43.0 kDa
  • TMD
  • 2
  • Sequence
  • MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • MARCH2
  • Full Name
  • Membrane associated ring-CH-type finger 2
  • Introduction
  • MARCH2 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH2 reduces surface accumulation of several glycoproteins and appears to regulate early endosome-to-trans-Golgi network (TGN) trafficking.
  • Alternative Names
  • MARCH2; MARCH2; RNF172; HSPC240; MARCH-II; E3 ubiquitin-protein ligase MARCHF2; E3 ubiquitin-protein ligase MARCH2; RING finger protein 172; RING-type E3 ubiquitin transferase MARCH2; RING-type E3 ubiquitin transferase MARCHF2; membrane associated ring finger 2; membrane-associated RING finger protein 2; membrane-associated RING-CH protein II; membrane-associated ring finger (C3HC4) 2, E3 ubiquitin protein ligase; Membrane associated ring-CH-type finger 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us