Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLEC5A (C-type lectin domain containing 5A) for Antibody Discovery (CAT#: MP0022Q)

This product is a 20.8 kDa Human CLEC5A membrane protein expressed in E. col. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC5A
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 20.8 kDa
  • TMD
  • 1
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMGSPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTN QNQNFNCATI GLTKTFDAAS CDISYRRICE KNAK

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Purity
  • >80% by SDS - PAGE
  • Buffer
  • 20 mM Tris-HCl buffer (pH8.0) containing 10% glycerol

Target

  • Target Protein
  • CLEC5A
  • Full Name
  • C-type lectin domain containing 5A
  • Introduction
  • This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined.
  • Alternative Names
  • CLECSF5; MDL-1; MDL1; C-type lectin domain family 5 member A; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5; C-type lectin superfamily member 5 myeloid DAP12-associating lectin-1; CLEC5A protein; cDNA FLJ51846, highly similar to C-type lectin domain family 5 member A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us