Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLIC2 (Chloride intracellular channel 2) Full Length (CAT#: MPC2027K) Made to Order

This product is a 28.3 kDa Human CLIC2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLIC2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 28.3 kDa
  • TMD
  • 1
  • Sequence
  • MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVT
    TVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYP
    HLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYL
    NTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKY
    RDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • His tag at the N-terminus
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CLIC2
  • Full Name
  • Chloride intracellular channel 2
  • Introduction
  • This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability.
  • Alternative Names
  • CLIC2; CLCNL2; CLIC2b; MRXS32; XAP121; chloride intracellular channel protein 2; Chloride intracellular channel 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us