Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLMP (CXADR like membrane protein) Expressed in CHO for Antibody Discovery, Partial (18-233aa) (CAT#: MPX0400K)

This product is a 25.2 kDa Human CLMP membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLMP
  • Protein Length
  • Partial (18-233aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 25.2 kDa
  • TMD
  • 1
  • Sequence
  • GTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIE
    WLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEP
    LKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLT
    LQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTM
    SYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGM

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CLMP
  • Full Name
  • CXADR like membrane protein
  • Introduction
  • This gene encodes a type I transmembrane protein that is localized to junctional complexes between endothelial and epithelial cells and may have a role in cell-cell adhesion. Expression of this gene in white adipose tissue is implicated in adipocyte maturation and development of obesity. This gene is also essential for normal intestinal development and mutations in the gene are associated with congenital short bowel syndrome.
  • Alternative Names
  • CLMP; ACAM; ASAM; CSBM; CSBS; CXADR-like membrane protein; CAR-like membrane protein; adipocyte-specific adhesion molecule; coxsackie- and adenovirus receptor-like membrane protein; CXADR like membrane protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us