Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLPTM1 (CLPTM1 regulator of GABA type A receptor forward trafficking) Expressed in Wheat germ, Full Length (CAT#: MPX0085K)

This product is a 85 kDa Human CLPTM1 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLPTM1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 85 kDa
  • TMD
  • 5
  • Sequence
  • MWSGRSSFTSLVVGVFVVYVVHTCWVMYGIVYTRPCSGDANCIQPYLARRPKLQLSVYTTTRSHLGAENNIDLVLNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYLPILFIDQLSNRVKDLMVINRSTTELPLTVSYDKVSLGRLRFWIHMQDAVYSLQQFGFSEKDADEVKGIFVDTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLVPAGVGAAIELWKVKKALKMTIFWRGLMPEFQFGTYSESERKTEEYDTQAMKYLSYLLYPLCVGGAVYSLLNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDKRRVNEFGESYEEKATRAPHTD

Product Description

  • Expression Systems
  • Wheat germ
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • pH: 8.00, Constituents: 0.31% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • CLPTM1
  • Full Name
  • CLPTM1 regulator of GABA type A receptor forward trafficking
  • Alternative Names
  • CLPTM1; Cleft lip and palate transmembrane protein 1; CLPTM1, transmembrane protein; cleft lip and palate associated transmembrane protein 1; CLPTM1 regulator of GABA type A receptor forward trafficking

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us