Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLTRN (Collectrin, amino acid transport regulator) Expressed in CHO for Antibody Discovery, Partial (15-141aa) (CAT#: MPX0176K)

This product is a 41 kDa Human CLTRN membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLTRN
  • Protein Length
  • Partial (15-141aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 41 kDa
  • TMD
  • 1
  • Sequence
  • ELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLF
    KAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVE
    VQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVP

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CLTRN
  • Full Name
  • Collectrin, amino acid transport regulator
  • Introduction
  • This gene encodes a type 1 transmembrane protein that is important for trafficking amino acid transporters to the apical brush border of proximal tubules. The encoded protein binds to amino acid transporters and regulates their expression on the plasma membrane. It also plays a role in controlling insulin exocytosis by regulating formation of the SNARE (soluble N-ethylmaleimide-sensitive-factor attachment protein receptor) complex in pancreatic beta cells. The extracellular domain of the encoded protein may be cleaved and shed from the plasma membrane specifically in pancreatic beta cells.
  • Alternative Names
  • CLTRN; NX17; NX-17; TMEM27; collectrin; kidney-specific membrane protein; transmembrane protein 27; Collectrin, amino acid transport regulator

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us