Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CMTM1 (CKLF like MARVEL transmembrane domain containing 1) Expressed in Wheat germ for Antibody Discovery, Partial (1-114aa) (CAT#: MPX0156K)

This product is a 35 kDa Human CMTM1 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CMTM1
  • Protein Length
  • Partial (1-114aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 35 kDa
  • TMD
  • 4
  • Sequence
  • MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFFILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGR

Product Description

  • Expression Systems
  • Wheat germ
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • pH: 8.00, Constituents: 0.31% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • CMTM1
  • Full Name
  • CKLF like MARVEL transmembrane domain containing 1
  • Introduction
  • This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. Alternatively spliced transcript variants encoding different isoforms have been identified. Naturally occurring read-through transcription occurs between this locus and the neighboring locus CKLF (chemokine-like factor).
  • Alternative Names
  • CMTM1; CKLFH; CKLFH1; CKLFSF1; CKLF-like MARVEL transmembrane domain-containing protein 1; chemokine-like factor super family 1; chemokine-like factor superfamily 1; chemokine-like factor superfamily member 1; chemokine-like factor-like protein CKLFH1; CKLF like MARVEL transmembrane domain containing 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us