Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CMTM7 (CKLF like MARVEL transmembrane domain containing 7) Full Length (CAT#: MPC1231K) Made to Order

This product is a 18.8 kDa Human CMTM7 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CMTM7
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 18.8 kDa
  • TMD
  • 4
  • Sequence
  • MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKV
    AQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFY
    RVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMA
    TFLCMASIWLSYKISCVTQSTDAAV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CMTM7
  • Full Name
  • CKLF like MARVEL transmembrane domain containing 7
  • Introduction
  • This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • CMTM7; CKLFSF7; CKLF-like MARVEL transmembrane domain-containing protein 7; chemokine-like factor super family 7; chemokine-like factor super family member 7 variant 2; chemokine-like factor superfamily 7; chemokine-like factor superfamily member 7; CKLF like MARVEL transmembrane domain containing 7

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us