Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CMTM8 (CKLF like MARVEL transmembrane domain containing 8) Full Length (CAT#: MPC1255K) Made to Order

This product is a 19.5 kDa Human CMTM8 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CMTM8
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 19.5 kDa
  • TMD
  • 4
  • Sequence
  • MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLPGFLIVAEIV
    LGLLVWTLIAGTEYFRVPAFGWVMFVAVFYWVLTVFFLIIYITMTYTRIP
    QVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAF
    LVTICYAGNTYFSFIAWRSRTIQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CMTM8
  • Full Name
  • CKLF like MARVEL transmembrane domain containing 8
  • Introduction
  • This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor, and plays a role in regulating the migration of tumor cells. The encoded protein is thought to function as a a negative regulator of epidermal growth factor-induced signaling. Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • CMTM8; CKLFSF8; CKLFSF8-V2; CKLF-like MARVEL transmembrane domain-containing protein 8; chemokine-like factor superfamily member 8; CKLF like MARVEL transmembrane domain containing 8

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us