Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human COQ3 (Coenzyme Q3, methyltransferase) Full Length (CAT#: MPC4474K) Made to Order

This product is a made-to-order Human COQ3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COQ3
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • Sequence
  • MWSGRKLGSSGGWFLRVLGPGGCNTKAARPLISSAVYVKNQLSGTLQIKP
    GVFNEYRTIWFKSYRTIFSCLNRIKSFRYPWARLYSTSQTTVDSGEVKTF
    LALAHKWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKI
    LDVGCGGGLLTEPLGRLGASVIGIDPVDENIKTAQCHKSFDPVLDKRIEY
    RVCSLEEIVEETAETFDAVVASEVVEHVIDLETFLQCCCQVLKPGGSLFI
    TTINKTQLSYALGIVFSEQIASIVPKGTHTWEKFVSPETLESILESNGLS
    VQTVVGMLYNPFSGYWHWSENTSLNYAAYAVKSRVQEHPASAEFVLKGET
    EELQANACTNPAVHEKLKK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • COQ3
  • Full Name
  • Coenzyme Q3, methyltransferase
  • Introduction
  • Ubiquinone, also known as coenzyme Q, or Q, is a critical component of the electron transport pathways of both eukaryotes and prokaryotes (Jonassen and Clarke, 2000 [PubMed 10777520]). This lipid consists of a hydrophobic isoprenoid tail and a quinone head group. The tail varies in length depending on the organism, but its purpose is to anchor coenzyme Q to the membrane. The quinone head group is responsible for the activity of coenzyme Q in the respiratory chain. The S. cerevisiae COQ3 gene encodes an O-methyltransferase required for 2 steps in the biosynthetic pathway of coenzyme Q. This enzyme methylates an early coenzyme Q intermediate, 3,4-dihydroxy-5-polyprenylbenzoic acid, as well as the final intermediate in the pathway, converting demethyl-ubiquinone to coenzyme Q. The COQ3 gene product is also capable of methylating the distinct prokaryotic early intermediate 2-hydroxy-6-polyprenyl phenol.
  • Alternative Names
  • COQ3; DHHBMT; bA9819.1; DHHBMTASE; UG0215E05; ubiquinone biosynthesis O-methyltransferase, mitochondrial; 2-polyprenyl-6-hydroxyphenol methylase; 2-polyprenyl-6-hydroxyphenyl methylase; 3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase; 3-demethylubiquinol 3-O-methyltransferase; 3-demethylubiquinone-10 3-methyltransferase; DHHB methyltransferase; DHHB-MTase; coenzyme Q3 homolog, methyltransferase; dihydroxyhexaprenylbenzoate methyltransferase; hexaprenyldihydroxybenzoate methyltransferase, mitochondrial; methyltransferase COQ3; polyprenyldihydroxybenzoate methyltransferase; Coenzyme Q3, methyltransferase

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us