Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human COX14 (Cytochrome c oxidase assembly factor COX14) Full Length (CAT#: MPC1416K) Made to Order

This product is a 6.6 kDa Human COX14 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX14
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 6.6 kDa
  • TMD
  • 1
  • Sequence
  • MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEE
    QKTSGIM

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • COX14
  • Full Name
  • Cytochrome c oxidase assembly factor COX14
  • Introduction
  • This gene encodes a small single-pass transmembrane protein that localizes to mitochondria. This protein may play a role in coordinating the early steps of cytochrome c oxidase (COX; also known as complex IV) subunit assembly and, in particular, the synthesis and assembly of the COX I subunit of the holoenzyme. Mutations in this gene have been associated with mitochondrial complex IV deficiency. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • COX14; PCAG1; MC4DN10; C12orf62; COX14 cytochrome c oxidase assembly homolog; COX14, cytochrome c oxidase assembly factor; cytochrome c oxidase assembly homolog 14; Cytochrome c oxidase assembly factor COX14

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us