Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human COX4I2 (Cytochrome c oxidase subunit 4I2) Full Length (CAT#: MPC2154K) Made to Order

This product is a 20 kDa Human COX4I2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX4I2
  • Protein Length
  • Full length
  • Protein Class
  • Oxidoreductase
  • Molecular Weight
  • 20 kDa
  • TMD
  • 1
  • Sequence
  • MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPE
    EPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSN
    EWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDM
    KVNPVQGLASRWDYEKKQWKK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • COX4I2
  • Full Name
  • Cytochrome c oxidase subunit 4I2
  • Introduction
  • Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation.
  • Alternative Names
  • COX4I2; COX4; COX4B; COX4-2; COX4L2; COXIV-2; dJ857M17.2; cytochrome c oxidase subunit 4 isoform 2, mitochondrial; COX IV-2; cytochrome c oxidase subunit IV-like 2; Cytochrome c oxidase subunit 4I2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us