Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human COX7B2 (Cytochrome c oxidase subunit 7B2) Full Length (CAT#: MPC2159K) Made to Order

This product is a 9 kDa Human COX7B2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX7B2
  • Protein Length
  • Full length
  • Protein Class
  • Oxidoreductase
  • Molecular Weight
  • 9 kDa
  • TMD
  • 1
  • Sequence
  • MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFC
    VATWVFTATQIGIEWNLSPVGRVTPKEWKHQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • COX7B2
  • Full Name
  • Cytochrome c oxidase subunit 7B2
  • Alternative Names
  • COX7B2; cytochrome c oxidase subunit 7B2, mitochondrial; cytochrome c oxidase polypeptide VIIb2; cytochrome c oxidase subunit VIIb2; Cytochrome c oxidase subunit 7B2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us