Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human STRIT1 (Small transmembrane regulator of ion transport 1) Full Length (CAT#: MPC2433K) Made to Order

This product is a made-to-order Human STRIT1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • STRIT1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MAEKAGSTFSHLLVPILLLIGWIVGCIIMIYVVFS

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • STRIT1
  • Full Name
  • Small transmembrane regulator of ion transport 1
  • Alternative Names
  • STRIT1; DWORF; sarcoplasmic/endoplasmic reticulum calcium ATPase regulator DWORF; SERCA regulator DWORF; Sarcoplasmic/endoplasmic reticulum calcium ATPase regulator DWORF; Small transmembrane regulator of ion transport 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us