Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human COX8C (Cytochrome c oxidase subunit 8C) Full Length (CAT#: MPC2160K) Made to Order

This product is a 8.1 kDa Human COX8C membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX8C
  • Protein Length
  • Full length
  • Protein Class
  • Oxidoreductase
  • Molecular Weight
  • 8.1 kDa
  • TMD
  • 1
  • Sequence
  • MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVV
    FFTTFLTPAAYVLGNLKQFRRN

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • COX8C
  • Full Name
  • Cytochrome c oxidase subunit 8C
  • Alternative Names
  • COX8C; COX8-3; cytochrome c oxidase subunit 8C, mitochondrial; COX VIII-3; cytochrome c oxidase polypeptide 8; cytochrome c oxidase polypeptide VIII; cytochrome c oxidase subunit 8-3; cytochrome c oxidase subunit VIII; cytochrome c oxidase subunit VIIIC; Cytochrome c oxidase subunit 8C

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us