Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CREB3 (cAMP responsive element binding protein 3) Full Length (CAT#: MPC2176K) Made to Order

This product is a 41.3 kDa Human CREB3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CREB3
  • Protein Length
  • Full length
  • Protein Class
  • Transcription
  • Molecular Weight
  • 41.3 kDa
  • TMD
  • 1
  • Sequence
  • MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEV
    DDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKE
    GTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQI
    LKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLE
    EQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSD
    TRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC
    VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLT
    RKGGWLPTGSPSVILQDRYSG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CREB3
  • Full Name
  • cAMP responsive element binding protein 3
  • Introduction
  • This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. This protein also plays a role in leukocyte migration, tumor suppression, and endoplasmic reticulum stress-associated protein degradation. Additional transcript variants have been identified, but their biological validity has not been determined.
  • Alternative Names
  • CREB3; LZIP; LUMAN; sLZIP; cyclic AMP-responsive element-binding protein 3; basic leucine zipper protein; cyclic AMP response element (CRE)-binding protein/activating transcription factor 1; leucin zipper proitein; small leucine zipper protein; transcription factor LZIP-alpha; cAMP responsive element binding protein 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us