Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CRLF2 (Cytokine receptor like factor 2) Expressed in NS0 for Antibody Discovery, Partial (25-231aa) (CAT#: MPX0624K)

This product is a 50.6 kDa Human CRLF2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CRLF2
  • Protein Length
  • Partial (25-231aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 50.6 kDa
  • TMD
  • 1
  • Sequence
  • GAAEGVQIQIIYFNLETVQVTWNASK
    YSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIR
    NGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEV
    QYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYP
    SDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CRLF2
  • Full Name
  • Cytokine receptor like factor 2
  • Introduction
  • This gene encodes a member of the type I cytokine receptor family. The encoded protein is a receptor for thymic stromal lymphopoietin (TSLP). Together with the interleukin 7 receptor (IL7R), the encoded protein and TSLP activate STAT3, STAT5, and JAK2 pathways, which control processes such as cell proliferation and development of the hematopoietic system. Rearrangement of this gene with immunoglobulin heavy chain gene (IGH) on chromosome 14, or with P2Y purinoceptor 8 gene (P2RY8) on the same X or Y chromosomes is associated with B-progenitor acute lymphoblastic leukemia (ALL) and Down syndrome ALL. Alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • CRLF2; CRL2; TSLPR; CRLF2Y; cytokine receptor-like factor 2; IL-XR; TSLP receptor; cytokine receptor CRL2 precusor; thymic stromal lymphopoietin protein receptor; thymic stromal-derived lymphopoietin receptor; Cytokine receptor like factor 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us