Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CSF1 (Colony stimulating factor 1) expressed in E. coli for Antibody Discovery (CAT#: MP0006Q)

This product is a 20.7 kDa Human CSF1 membrane protein expressed in E. col. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CSF1
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
  • Molecular Weight
  • 20.7 kDa
  • TMD
  • 1
  • Sequence
  • MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ DVVTKPDCN

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Purification
  • Conventional chromatography
  • Purity
  • >90% by SDS - PAGE
  • Buffer
  • 20 mM Tris-HCl buffer (pH 8.0), 2 mM DTT, 10% glycerol

Target

  • Target Protein
  • CSF1
  • Full Name
  • Colony stimulating factor 1
  • Introduction
  • The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • CSF-1; MCSF; macrophage colony-stimulating factor 1; colony stimulating factor 1 (macrophage); lanimostim; M-CSF

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us