Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PAQR8 (Progestin and adipoQ receptor family member 8) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX3433K)

This product is a Human PAQR8 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PAQR8
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 7
  • Sequence
  • MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • PAQR8
  • Full Name
  • Progestin and adipoQ receptor family member 8
  • Alternative Names
  • PAQR8; MPRB; LMPB1; C6orf33; membrane progestin receptor beta; lysosomal membrane protein in brain-1; mPR beta; membrane progesterone P4 receptor beta; membrane progesterone receptor beta; progesterone and adipoQ receptor family member 8; progestin and adipoQ receptor family member VIII; Progestin and adipoQ receptor family member 8

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us