Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CXADR (CXADR Ig-like cell adhesion molecule) Expressed in NS0 for Antibody Discovery, Partial (20-237aa) (CAT#: MPX0157K)

This product is a 50.6 kDa Human CXADR membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CXADR
  • Protein Length
  • Partial (20-237aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 50.6 kDa
  • TMD
  • 1
  • Sequence
  • LSITTPEEMIEKAKGETAYLPCKFTLSPEDQ
    GPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKS
    GDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDG
    SEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVK
    NASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CXADR
  • Full Name
  • CXADR Ig-like cell adhesion molecule
  • Introduction
  • The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Several transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene are found on chromosomes 15, 18, and 21.
  • Alternative Names
  • CXADR; CAR; HCAR; CAR4/6; coxsackievirus and adenovirus receptor; 46 kD coxsackievirus and adenovirus receptor (CAR) protein; CVB3-binding protein; HCVADR; coxsackie virus and adenovirus receptor; coxsackievirus B-adenovirus receptor; CXADR Ig-like cell adhesion molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us