Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CXCR5 (C-X-C motif chemokine receptor 5) for Antibody Discovery (CAT#: MP1347J)

This product is a 41.9 kDa Human CXCR5 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CXCR5
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 41.9 kDa
  • TMD
  • 7
  • Sequence
  • MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSL IFLLGVIGNVLVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTF LCKTVIALHKVNFYCSSLLLACIAVDRYLAIVHAVHAYRHRRLLSIHITCGTIWLVGFLL ALPEILFAKVSQGHHNNSLPRCTFSQENQAETHAWFTSRFLYHVAGFLLPMLVMGWCYVG VVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSL PVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSL SESENATSLTTF

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CXCR5
  • Full Name
  • C-X-C motif chemokine receptor 5
  • Introduction
  • This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
  • Alternative Names
  • BLR 1; BLR1; Burkitt lymphoma receptor 1; Burkitt lymphoma receptor 1 GTP binding protein; Burkitt lymphoma receptor 1; GTP binding protein (chemokine (C-X-C motif) receptor 5); C X C chemokine receptor type 5; C-X-C chemokine receptor type 5; CD 185; CD185; CD185 antigen; Chemokine (C-X-C motif) receptor 5; Chemokine C X C motif receptor 5; Chemokine CXC motif receptor 5; Chemokine receptor 5; CXC chemokine receptor type 5; CXC R5; CXC-R5; CXCR 5; CXCR-5; Cxcr5; CXCR5_HUMAN; MDR 15; MDR-15; MDR15; MGC117347; Monocyte derived receptor 15; Monocyte-derived receptor 15

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us