Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CXCR6 (C-X-C motif chemokine receptor 6) Full Length (CAT#: MPC0076K) Made to Order

This product is a 39.2 kDa Human CXCR6 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CXCR6
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 39.2 kDa
  • TMD
  • 7
  • Sequence
  • MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNS
    LVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQV
    MCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKV
    TSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGF
    FLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLM
    KFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW
    KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CXCR6
  • Full Name
  • C-X-C motif chemokine receptor 6
  • Introduction
  • The protein encoded by this gene is a G protein-coupled receptor with seven transmembrane domains that belongs to the CXC chemokine receptor family. This family also includes CXCR1, CXCR2, CXCR3, CXCR4, CXCR5, and CXCR7. This gene, which maps to the chemokine receptor gene cluster, is expressed in several T lymphocyte subsets and bone marrow stromal cells. The encoded protein and its exclusive ligand, chemokine ligand 16 (CCL16), are part of a signalling pathway that regulates T lymphocyte migration to various peripheral tissues (the liver, spleen red pulp, intestine, lungs, and skin) and promotes cell-cell interaction with dendritic cells and fibroblastic reticular cells. CXCR6/CCL16 also controls the localization of resident memory T lymphocytes to different compartments of the lung and maintains airway resident memory T lymphocytes, which are an important first line of defense against respiratory pathogens. The encoded protein serves as an entry coreceptor used by HIV-1 and SIV to enter target cells, in conjunction with CD4.
  • Alternative Names
  • BONZO; CD186; CDw186; STRL33; TYMSTR; C-X-C chemokine receptor type 6; G protein-coupled receptor; G-protein coupled receptor STRL33; G-protein coupled receptor bonzo; chemokine (C-X-C motif) receptor 6; CXCR6; C-X-C motif chemokine receptor 6

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us