Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CYBA (Cytochrome b-245 alpha chain) Full Length (CAT#: MPC3996K) Made to Order

This product is a made-to-order Human CYBA membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CYBA
  • Protein Length
  • Full length
  • Protein Class
  • Oxidoreductase
  • TMD
  • 1
  • Sequence
  • MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVC
    LLEYPRGKRKKGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVP
    AGFLLATILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQ
    PPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • CYBA
  • Full Name
  • Cytochrome b-245 alpha chain
  • Introduction
  • Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated with autosomal recessive chronic granulomatous disease (CGD), that is characterized by the failure of activated phagocytes to generate superoxide, which is important for the microbicidal activity of these cells.
  • Alternative Names
  • CYBA; CGD4; p22-PHOX; cytochrome b-245 light chain; cytochrome b light chain; cytochrome b(558) alpha chain; cytochrome b(558) alpha-subunit; cytochrome b, alpha polypeptide; cytochrome b-245, alpha polypeptide; cytochrome b558 subunit alpha; flavocytochrome b-558 alpha polypeptide; neutrophil cytochrome b 22 kDa polypeptide; p22 phagocyte B-cytochrome; p22phox; superoxide-generating NADPH oxidase light chain subunit; Cytochrome b-245 alpha chain

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us